PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta009542
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family HD-ZIP
Protein Properties Length: 261aa    MW: 29319 Da    PI: 7.7385
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-72482548PU_refplantGDBView CDS
gnl|UG|Pta#S15797996PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.45.6e-19187241256
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                rk+ +++keq   Lee F++n+ ++ ++++ LAkkl+L  rqV vWFqNrRa+ k
  Pta009542 187 RKKLRLSKEQSALLEESFKENSSLNPKQKQALAKKLNLRPRQVEVWFQNRRARXK 241
                778899***********************************************98 PP

2HD-ZIP_I/II107.78.6e-35187258172
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkrayda 72 
                  +kk+rlskeq++lLEesF+e++ L+p++K++la++L+l+prqv+vWFqnrRAR k+kq+E+d+e+Lkr+++ 
    Pta009542 187 RKKLRLSKEQSALLEESFKENSSLNPKQKQALAKKLNLRPRQVEVWFQNRRARXKLKQTEVDCEFLKRCCEX 258
                  69********************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046185.8E-1029137IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466892.44E-18181244IPR009057Homeodomain-like
PROSITE profilePS5007117.67183243IPR001356Homeobox domain
SMARTSM003894.3E-17185247IPR001356Homeobox domain
CDDcd000868.47E-18187244No hitNo description
Gene3DG3DSA:1.10.10.609.2E-18187241IPR009057Homeodomain-like
PfamPF000462.8E-16187241IPR001356Homeobox domain
PROSITE patternPS000270218241IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
CLFLSSLLHH QSIFPWRFYI LKKQMGMDME DCNTGLGLGM SIGLGMNLMR EDLQSHRHHV  60
NGPPVQLDLL PLAPVLPSRD LPWGKTSPGT DGERSAGESK ATVPRRIDVN KLPASCYYNE  120
DTGTINVSSP NSALSSFHVD SGGAINAESS CYGMSVKRER EATEELEAER ACSRVSDEEA  180
DQEGGTRKKL RLSKEQSALL EESFKENSSL NPKQKQALAK KLNLRPRQVE VWFQNRRARX  240
KLKQTEVDCE FLKRCCEXXX X
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185191TRKKLRL
2235243RRARXKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.114880.0root| shoot| xylem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002322729.22e-56hypothetical protein POPTR_0016s05890g
RefseqXP_002534537.14e-56PREDICTED: homeobox-leucine zipper protein HOX11
TrEMBLA9NKN41e-165A9NKN4_PICSI; Putative uncharacterized protein
STRINGPOPTR_0016s05890.16e-56(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17460.19e-34Homeobox-leucine zipper protein 4 (HB-4) / HD-ZIP protein